PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Tp57577_TGAC_v2_mRNA27571
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Trifolieae; Trifolium
Family G2-like
Protein Properties Length: 661aa    MW: 74466.5 Da    PI: 9.6026
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Tp57577_TGAC_v2_mRNA27571genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like101.17.4e-32476529255
                    G2-like   2 prlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55 
                                pr+rWt++LH+rFv+ave LGG+e+AtPk++lelm+vk+Ltl+hvkSHLQ+YR+
  Tp57577_TGAC_v2_mRNA27571 476 PRMRWTSTLHARFVHAVELLGGHERATPKSVLELMDVKDLTLAHVKSHLQMYRT 529
                                9****************************************************7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466894.48E-15473529IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.603.2E-28474529IPR009057Homeodomain-like
TIGRFAMsTIGR015571.9E-23476529IPR006447Myb domain, plants
PfamPF002491.4E-6477528IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009887Biological Processorgan morphogenesis
GO:0009944Biological Processpolarity specification of adaxial/abaxial axis
GO:0009956Biological Processradial pattern formation
GO:0010051Biological Processxylem and phloem pattern formation
GO:0010158Biological Processabaxial cell fate specification
GO:0010229Biological Processinflorescence development
GO:0048481Biological Processplant ovule development
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 661 aa     Download sequence    Send to blast
MVVGSAFENE EDAMIRRKPQ VRRRKGQEKW DLHRTLASFL VGGSLASLSK ILALFYFFSS  60
FFSHYFWVRS SDKPPFKRVI IVSHSRELEY FIKLFKYFSL GEHSSLLYKT PKTPQSDHES  120
NTCGNDQHND VRSQLYIFIQ RRHCAQEHFL ACEYCTLISF FLFFLVYFNK RKKKKSYIFC  180
NHQGRKLFLK KMPLEGIFIE ATSTPPDLSL HISPPSTSSL ICNNNSTHQL LNYDAHNSSS  240
TNFISSRTLA QTQAQTQAHT ELSLGRNFSG GVGXXXXXXX XXXXXXQQPH NPYFPHLQHH  300
HNSTTSTTTP ISTSPNSSHM NHINYGVSLL DMSSSSSEAL RPIKGIPVYH NRSFPFLPAM  360
EHSREKDPKM CLYHHMPNSP TPSPSSSSSP LSPYITPGGL DPMSFLNSSG SAAAYRAAVA  420
TRFNNEPFKS HQYPLHHHHH HHHSHYGSVG LGASEASMMR SRFLPKLPTK RSMRAPRMRW  480
TSTLHARFVH AVELLGGHER ATPKSVLELM DVKDLTLAHV KSHLQMYRTV KTTDKPAASS  540
DGSGEDDVPQ IGSNGGIRQF SDQRGLTDRP LQQDMDYSST TTLWSNSSSS REPWPPTSSN  600
DVDGFRPTIF QSQPISGGHQ IQECDSNQLK NNLSGSNLEC KNPSLEFTLG IPDWNGKGQA  660
*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC1474720.0AC147472.18 Medicago truncatula clone mth2-24n18, complete sequence.
GenBankCR9403060.0CR940306.3 M.truncatula DNA sequence from clone MTH2-10B11 on chromosome 3, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003600664.20.0transcription factor KAN2
SwissprotQ93WJ96e-80KAN1_ARATH; Transcription repressor KAN1
TrEMBLG7J8N80.0G7J8N8_MEDTR; Transcription factor KAN2
STRINGGLYMA11G33356.11e-165(Glycine max)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G16560.16e-69G2-like family protein